
CAS 77591-33-4
TB-500
- Delivery in 1–3 days
- Free reshipping guarantee
- High purity
- In stock
TB-500
10 MG · €39.95
All products are sold strictly for laboratory research use only. Not for human or veterinary use, nor for use as food, drugs, cosmetics or medical devices.
Storage
Ungeöffnetes Vial bei 2–8 °C lichtgeschützt lagern. Nach Rekonstitution bei 2–8 °C aufbewahren und innerhalb von 28 Tagen verwenden.
Description
TB-500 ist ein synthetisches Fragment von Thymosin β-4 — einem natürlich vorkommenden Peptid aus 43 Aminosäuren, das in nahezu jedem Zelltyp von Säugetieren vorkommt. Das als TB-500 isolierte Fragment entspricht der aktiven Aktin-bindenden Region des Ausgangsmoleküls und wird hinsichtlich seiner Rolle bei zellulärer Regeneration, Angiogenese und Follikelaktivität untersucht.
In Forschungsmodellen wurde TB-500 auf seine Effekte auf Aktin-Sequestrierung und -Polymerisation, Wundheilungskinetik, Kapillarwachstum und Haarfollikel-Unterstützung untersucht. In Forschungs-Stacks wird es am häufigsten mit BPC-157 kombiniert (die sogenannte Wolverine-Kombination), da beide Peptide komplementäre Signalwege der Geweberegeneration adressieren.
Jedes Vial enthält 10 mg lyophilisiertes TB-500 mit ≥99% Reinheit, chargenweise verifiziert per HPLC und Massenspektrometrie. Ein Analysezertifikat (COA) eines unabhängigen Labors ist auf Anfrage erhältlich. Ausschließlich für die Laborforschung — nicht zur Anwendung am Menschen oder zur Injektion bestimmt.
Specifications
| CAS number | 77591-33-4 |
|---|---|
| Catalog number | MYPTB |
| SKU | MYPTB10 |
| Purity | ≥99% |
| Specification | 10 MG |
| Molecular weight | 4,963.44 Da |
| Molecular formula | C₂₁₂H₃₅₀N₅₆O₇₈S |
| Storage | Ungeöffnetes Vial bei 2–8 °C lichtgeschützt lagern. Nach Rekonstitution bei 2–8 °C aufbewahren und innerhalb von 28 Tagen verwenden. |
| Amino acid sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (Thymosin β-4 full sequence; TB-500 corresponds to the 17-amino-acid active fragment LKKTETQ within this parent sequence) |
Frequently asked questions
What are the delivery times?
Your order is dispatched within 24 business hours after payment is confirmed, sent tracked via FedEx. From dispatch, allow 1 to 3 business days for metropolitan France and 2 to 5 business days for the rest of Europe. A tracking number is sent to you by email as soon as the parcel is collected. These times are indicative and depend on the destination.
Which payment methods do you accept?
You can conveniently pay by SEPA transfer or by credit card (Visa and Mastercard, secured by 3-D Secure). In addition, Apple Pay, Google Pay and Klarna are available to you. You choose the option that suits you at checkout. We do not store any card details; payments are processed by industry-compliant payment providers.
How pure are your peptides?
Every batch is certified to a purity of at least 98%, with most references reaching 99% or higher. The exact purity of each reference is listed on its product page. Each batch is analysed by an independent third-party laboratory using HPLC and mass spectrometry to measure purity and confirm the identity of the compound before it is added to the catalogue. These products are intended exclusively for in-vitro research and laboratory use.
What is TB-500?
TB-500 is a synthetic research peptide, a fragment of thymosin β-4 (a natural 43-amino-acid peptide present in almost all mammalian cell types). It corresponds to the active actin-binding region of the parent molecule. Its molecular weight is approximately 4,963.44 Da (CAS 77591-33-4). It is studied in in-vitro research models addressing cellular regeneration and angiogenesis. For in-vitro research and laboratory use only — not for human or animal consumption, not approved by the EMA, the FDA or any medicines authority.
How should TB-500 be stored?
Store the unopened vial at 2-8°C, protected from light. The lyophilized vial stays stable at room temperature during transport, with no cold chain required. Once reconstituted in bacteriostatic water, store at 2-8°C and use within 28 days; do not refreeze the reconstituted solution.
What does the Certificate of Analysis (CoA) for TB-500 show?
The Certificate of Analysis (CoA) reports HPLC purity of ≥99%, compound identity confirmed by mass spectrometry, the batch number and the net vial content. It is issued per batch and can be consulted on the product page. For in-vitro research and laboratory use only — not for human or animal consumption, not approved by the EMA, the FDA or any medicines authority.
Where can I find the certificate of analysis (CoA) for a product?
Every batch comes with a certificate of analysis (CoA) that states the purity measured by HPLC, the identity confirmed by mass spectrometry and the corresponding batch number. The CoA is available on the relevant product page and can additionally be viewed via the /coa page. The analyses are carried out by an independent third-party laboratory.
Is the packaging neutral and discreet?
All orders are shipped in neutral, discreet packaging. The outside of the parcel carries no marking and no mention of the contents or the nature of the products. Nothing indicates the name of the shop or the type of items inside.
What is the legal status of the products sold on monpept?
The products offered are for in-vitro research and laboratory use only. They are not for human or animal consumption and are not approved by the EMA, the FDA or any medicines authority. When placing an order, the buyer confirms that they will be used strictly for research purposes. No medical or therapeutic claim is associated with these compounds.
How much does shipping cost?
For France, shipping costs €9.95. It is free from €250 of purchase, a threshold that applies to all destinations. For other countries, shipping is calculated at checkout according to the destination, starting from €8.95.
Which countries do you ship to?
We deliver throughout the European Union, as well as to Switzerland, the United Kingdom and Norway. All orders are dispatched from our European warehouse. Costs and delivery times vary by destination and are shown to you at checkout.
How can I track my order status and shipment?
Every order is shipped as a tracked DHL shipment. As soon as DHL collects the parcel, you receive an email with the tracking number, which lets you follow your parcel through to delivery. If you have questions about an order, please quote your order number so that we can help you more quickly.
How does payment by SEPA transfer work?
After you have placed your order, you receive an email with our bank details (IBAN and BIC) as well as your order number. Please quote this order number as the payment reference so that we can clearly assign your payment. As soon as the amount reaches us – usually within 1 to 2 business days – we prepare your order for dispatch and send you a confirmation.
Is card payment secure?
Card payments are secured by the 3-D Secure protocol, which adds an authentication step with your bank. monpept does not store any of your card details. Transactions are processed by payment providers that comply with industry standards.
Are your peptides tested by an independent laboratory?
Yes. Every batch is analysed by an independent third-party laboratory before it is listed. Testing includes HPLC analysis to measure purity and mass spectrometry to confirm the identity and molecular weight of the compound. No batch is offered for sale until these analyses have been completed, and the results are recorded in the certificate of analysis for each batch.
How should I store lyophilized vials before reconstitution?
Lyophilized vials can be stored at -20°C for up to 24 months, protected from light and moisture. In this form the compounds remain stable at room temperature during transport, which means no cold chain is required for shipping. Keep the vials in their original packaging until they are used in the laboratory.
How should I store a peptide after reconstitution?
After reconstitution in bacteriostatic water, store the solution at 2-8°C and use it within 28 days. Do not refreeze a solution that has already been reconstituted. When reconstituting, let the water run gently down the wall of the vial and dissolve without shaking vigorously, in order to preserve the integrity of the compound.
Can I withdraw from or return my order?
Because of the nature of the research compounds, sealed vials are excluded from return: once an order has been shipped or a vial has been opened, no return is possible. As long as an order has not yet been shipped, you can cancel it – please contact us by email promptly and we will cancel the order before it is handed to the carrier. After handover to the carrier, cancellation is no longer possible.
What should I do if my parcel is damaged, incomplete or lost?
If your parcel arrives damaged or incomplete, or is lost in transit, please contact us by email within 48 hours and attach photos of the parcel and its contents. After verification, we arrange a free replacement. Reporting quickly with photos helps us handle your request promptly.
Who can order from monpept?
Orders are restricted to people aged 18 and over: professionals, laboratories and researchers. At checkout, the buyer accepts the research use agreement and confirms that the products will be used only for in-vitro and laboratory research. These compounds are not for human or animal consumption.
How can I contact monpept customer support?
monpept support can be reached by email at [email protected]. We usually reply within 1 business day. For any question about an order, please include your order reference in your message to speed up handling. Support is provided by email only.